Dataset for protein Mcl-1 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B4DLY8_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL--------------------ATEK
B4DG83_MCL1-01      -------------------MEAPAADAIMSPEEELD--------------------GYEP
B4E3L8_MCL1-01      -------------------MEAPAADAIMSPEEELD--------------------GYEP
B4DU51_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEMEAPAADAIMSPEEELDGYEP
C8YZ26_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL------------------------
Q07820_MCL1-04      MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL------------------------
                                         ...:..   *   *                         

B4DLY8_MCL1-01      EASARRE--------IGGGEAGAVIGGSAGASPPSTLTPDSR-------------RVARP
B4DG83_MCL1-01      EPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4E3L8_MCL1-01      EPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4DU51_MCL1-01      EPLGKRPAVLPLLELVGESGNNTSTDGSLPLTPPPAEEEEDELYRQSLEIISRYLREQAT
C8YZ26_MCL1-01      ----------------------------------------------------------AT
Q07820_MCL1-04      ----------------------------------------------------------AT
                                                                               .

B4DLY8_MCL1-01      PPKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
B4DG83_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
B4E3L8_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
B4DU51_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
C8YZ26_MCL1-01      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRRLDIKNEDDVKSLSRVMI
Q07820_MCL1-04      GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMI
                     .****************************************.*****************

B4DLY8_MCL1-01      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
B4DG83_MCL1-01      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
B4E3L8_MCL1-01      HVFSDSVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
B4DU51_MCL1-01      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
C8YZ26_MCL1-01      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
Q07820_MCL1-04      HVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRG
                    *****.******************************************************

B4DLY8_MCL1-01      WDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
B4DG83_MCL1-01      WDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
B4E3L8_MCL1-01      WDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
B4DU51_MCL1-01      WDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
C8YZ26_MCL1-01      WDGFVEFFQVEDLEGGIRNVLLAFAGVAGVGAGLAYLKR
Q07820_MCL1-04      WDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    ********:**************************** *

© 1998-2020Legal notice