Dataset for protein Bfl1 of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B4E1X9_BCL2A1-01      MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
Q16548_BCL2A1-01      MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
                      **************************************************

B4E1X9_BCL2A1-01      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
Q16548_BCL2A1-01      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                      **************************************************

B4E1X9_BCL2A1-01      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWVCVMEK----
Q16548_BCL2A1-01      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
                      ****************************************   : *    

B4E1X9_BCL2A1-01      ------FFIVLSCEIEIENFLAS--
Q16548_BCL2A1-01      KSGWMTFLEVTGKICEMLSLLKQYC
                            *: * .   *: .:* .  

© 1998-2020Legal notice