Dataset for protein Bcl-w of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YPX6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A2I2YPX6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A2I2YPX6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A2I2YPX6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                        **:.*:*. : . ...  .   *..  * ***  .***.....   .   

A0A2I2YPX6_BCL2L2-      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
A0A2I2YPX6_BCL2L2-      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
A0A2I2YPX6_BCL2L2-      ESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
A0A2I2YPX6_BCL2L2-      ESEELEPED------------------------------------QEEEE
                         .:*:*.                                      .  : 

A0A2I2YPX6_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A2I2YPX6_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A2I2YPX6_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
A0A2I2YPX6_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
                        .  *.:*.*. * :                                    

A0A2I2YPX6_BCL2L2-      RLADWIHSSGGWA-EFTALYGDGALEEARRLRE---------------GN
A0A2I2YPX6_BCL2L2-      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2I2YPX6_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2I2YPX6_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
                                  .   *          *** .*.*               **

A0A2I2YPX6_BCL2L2-      WASV------------RTVLTGAVALGALVT-------------------
A0A2I2YPX6_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2I2YPX6_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2I2YPX6_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
                         ..*            *:: .* *  ** .                    

A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAIICSSLT
A0A2I2YPX6_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK------------
A0A2I2YPX6_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK------------
                                                                          

A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      QVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRV
A0A2I2YPX6_BCL2L2-      -VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRV
A0A2I2YPX6_BCL2L2-      -VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRV
                                                                          

A0A2I2YPX6_BCL2L2-      ------VGAFFASK
A0A2I2YPX6_BCL2L2-      YRGRARATSWYSPY
A0A2I2YPX6_BCL2L2-      YRGRARATSWYSPY
A0A2I2YPX6_BCL2L2-      YRGRARATSWYSPY
                              . ::::. 

© 1998-2022Legal notice