Dataset for protein BCL-2-like of organism Ficedula albicollis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803V184_BCL2A1-      -----------METAEFYYVYYLAQDYLQYVLQESH--------------
A0A803VLI1_BCL2L1-      ------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEM
A0A803VR88_BCL2-02      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAA
A0A803VR88_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAA
                                    * .  :  * *:*   .:   *                

A0A803V184_BCL2A1-      -----------------------------------LGPAQTRVAHVLRTM
A0A803VLI1_BCL2L1-      DGVLNGSPSWHA---PTSHIVNGASVHQSSLEVHEIRRAAD-VRQALREA
A0A803VR88_BCL2-02      VAAAAGTSSDHTGPVSPHPEPPGSAAASPAPPAEGLRPAPQVVHLVLRQA
A0A803VR88_BCL2-01      VAAAAGTSSDHTGPVSPHPEPPGSAAASPAPPAEGLRPAPQVVHLVLRQA
                                                           :  *   *  .**  

A0A803V184_BCL2A1-      ASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTNWGRIM
A0A803VLI1_BCL2L1-      GDEFELRYRRAFSDLTSQLHITPSTAYQS-FEQVVNELFRDG-VNWGRIV
A0A803VR88_BCL2-02      GDEFSRRYQRDFAQMSGQLHLTPFTARSR-FVAVVEELFRDG-VNWGRIV
A0A803VR88_BCL2-01      GDEFSRRYQRDFAQMSGQLHLTPFTARSR-FVAVVEELFRDG-VNWGRIV
                        ...:. .    :  : ..: :*. :. .  *  *::* * ** .*****:

A0A803V184_BCL2A1-      TIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWIDANGGW
A0A803VLI1_BCL2L1-      AFFSFGGALCVESVVKEMRVLV---KRIVSWMTTYLTDHLDPWIQENGGW
A0A803VR88_BCL2-02      AFFEFGGVMCVESVNREMSPLV---DSIAAWMTEYLNRHLHNWIQDNGGW
A0A803VR88_BCL2-01      AFFEFGGVMCVESVNREMSPLV---DSIAAWMTEYLNRHLHNWIQDNGGW
                        ::* *** :  :   . :   .   . *  ::* *:  :   **: ****

A0A803V184_BCL2A1-      E-------NGFLTKFERRSLLSFSKITALFIAVVSLFREYY---
A0A803VLI1_BCL2L1-      ERFVDLYGNDAAAEVDPSPVAATL--------------------
A0A803VR88_BCL2-02      D----------RSCFAKYFFVAAQLWIPALDTNTRAIHASPLEK
A0A803VR88_BCL2-01      DAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
                        :           . .    .                        

© 1998-2022Legal notice