Dataset for protein BCL-2-like of organism Equus asinus asinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4L244_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGGGGASSPGGRLLAAGKEATARREGGG
A0A8C4L1K6_BCL2-01      ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYE
A0A8C4L2X1_BCL2L1-      ---------------------------MSQSNRELVVDFLSYKLSQKGYN
A0A8C4LWK5_BCL2L2-      ----------------------MATPASAPDTRALVADFVGYKLRQKGY-
A0A8C4PQL1_BCL2A1-      -----------------------MTDCEFGYIHMLAQDYLKYVLQ-----
                                                          :               

A0A8C4L244_MCL1-01      GEAGAVIGGSAGGSPQTTLAPDSLRVARPSPIGAEGPDVTAPPSRLRFFA
A0A8C4L1K6_BCL2-01      WD-----AGDAGAAPLGATPVPGIFSSQP---------------------
A0A8C4L2X1_BCL2L1-      WSQFSDVEENRTEAPEGTESEMETPSAIN---------------------
A0A8C4LWK5_BCL2L2-      -----------------------VCGAGP---------------------
A0A8C4PQL1_BCL2A1-      -----------------------IPQPGS---------------------
                                                  .                       

A0A8C4L244_MCL1-01      PTRCASPPEGMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLEFVREA
A0A8C4L1K6_BCL2-01      ----------------------------------GRTPAPARTSPLLPPA
A0A8C4L2X1_BCL2L1-      ----------------------------------GNPSWHLADSPTGNGA
A0A8C4LWK5_BCL2L2-      ----------------------------------GEGPAA----------
A0A8C4PQL1_BCL2A1-      ----------------------------------GPSKTS----------
                                                          *               

A0A8C4L244_MCL1-01      SSGPCTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A8C4L1K6_BCL2-01      APAGAAGPALSPVP-PVVH-------------------------------
A0A8C4L2X1_BCL2L1-      TGHSSSLDAREVIPMAAVK-------------------------------
A0A8C4LWK5_BCL2L2-      ---------------DPLH-------------------------------
A0A8C4PQL1_BCL2A1-      ---------------RVLQ-------------------------------
                                                                          

A0A8C4L244_MCL1-01      GSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A8C4L1K6_BCL2-01      ----------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A8C4L2X1_BCL2L1-      ----------QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A8C4LWK5_BCL2L2-      ----------QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A8C4PQL1_BCL2A1-      ----------DIAFSVQNEVEKNLKPCLDNFHV---VSIDAARTIFNQVM
                                       . : .. .    :  :     :.       :  * 

A0A8C4L244_MCL1-01      AHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAE---SITDV
A0A8C4L1K6_BCL2-01      EELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL---WMTEY
A0A8C4L2X1_BCL2L1-      NELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT---WMATY
A0A8C4LWK5_BCL2L2-      DELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQE---WMVAY
A0A8C4PQL1_BCL2A1-      EKQFEDGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEF
                           * .*  ****::::: * . :            :         :.  

A0A8C4L244_MCL1-01      LVRTKRDWLVKQRGWDGFVEFFHVEDLEGG-------------IRNVLLA
A0A8C4L1K6_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPSM-------RPLFDFSWLSLKALLSL
A0A8C4L2X1_BCL2L1-      LNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFN------RWFLTG
A0A8C4LWK5_BCL2L2-      LETRLADWIHSSGGWAEFTALYGDGALEEA---RRLREGNWASVRTVLTG
A0A8C4PQL1_BCL2A1-      ITKNTGEWIRQNGGWE-------NGFVKKF---E--PKSGWL---TFLEV
                        :      *: .. **                               .*  

A0A8C4L244_MCL1-01      FAGVAGVGAGLAYLIR-
A0A8C4L1K6_BCL2-01      A-LVGACITLGAYLGHK
A0A8C4L2X1_BCL2L1-      M-TVAGVVLLGSLFSRK
A0A8C4LWK5_BCL2L2-      AVALGALVTVGAFFASK
A0A8C4PQL1_BCL2A1-      TGKMCEILFLKQYY---
                           :             

© 1998-2022Legal notice