Dataset for protein BCL-2-like of organism Epinephelus coioides

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A219P0Y3_BCL2L1-      -MCQNRELVVCYIKYKLTQRNYPLNHMGLIEPPNRTDGGEAGLGEEQRVA
A0A510BW31_BCL2L1-      MSYSNRELVEFFVSYKLSQRNHPTSLL-------RPEGAEGRTERDKASS
                           .*****  ::.***:***:* . :       *.:*.*.    ::  :

A0A219P0Y3_BCL2L1-      THANGTF-----NGMSPGTPPASPLRQQQLPSTTSLDAVKEALRDSANEF
A0A510BW31_BCL2L1-      AASNGLLVNSRNGGSQPGTSS---------PPHGDIEAVKAALRDSADEF
                        : :** :     .* .***..         *.  .::*** ******:**

A0A219P0Y3_BCL2L1-      ELRYARAFSDLHHQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFG
A0A510BW31_BCL2L1-      ELLFTQSFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRVVGLFAFG
                        ** ::.:****  ** *** ***:**:.******.*******:*******

A0A219P0Y3_BCL2L1-      GALCVECVEKEMSPLVGRIIEWKTRYLDNHIQPWIQSQRGWERFAEIFGQ
A0A510BW31_BCL2L1-      GVLCVECVEKDMSELVSRITDWMTTYLDEHINPWIQTQGGWDCFAEIFGQ
                        *.********:** **.** :* * ***:**:****:* **: *******

A0A219P0Y3_BCL2L1-      DAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A510BW31_BCL2L1-      NSAAEARRSQESLRRWLLVGVALLMGVLVGVVIAKNH-
                        ::***:******:..***.*::*: **:** :**::. 

© 1998-2020Legal notice