Dataset for protein Bcl-xL of organism Echeneis naucrates

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A665VM40_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMEFNESLHRTDGGGAGLVEEQRVA
A0A665VSD7_BCL2L1-      MSYSNRELVEFFIHSKL-----PLASL-----LRPEDAGGQTEGDKANSA
                           .***** *:*: **     **  :     *.  *.**    :: . *

A0A665VM40_BCL2L1-      THSNGTFNGTSSGTRSESPQGQQHLASMTSLDAVKEALLDSANEFELRYS
A0A665VSD7_BCL2L1-      ARNGLPVISGSMLSYTRTPP-----PPPCDIEAVKEALRDSTDEFEFLFR
                        :... .. . *  : : :*      ..  .::****** **::***: : 

A0A665VM40_BCL2L1-      RAFSDLHNQLHITPATAYISFENVMDEVFRDGVNWGRIIGLFVFGGALCV
A0A665VSD7_BCL2L1-      QAFSDLSSQLDITSDTVYQSFETVMDEVFKDGINWGRIVALFAFGGELCV
                        .***** .** **. *.* ***.******.**:*****:.**.*** ***

A0A665VM40_BCL2L1-      ECVEKEMSPLVVRIIEWMTVYLDNNIQPWIQGQGGWEHFAELFGHDAAAE
A0A665VSD7_BCL2L1-      ECVEKNMSEMVPSIAEWMTIYLDLHIRPWIETQGGWDCFAEIFGQNSAAT
                        *****:** :*  * ****:*** :*.***: ****: ***:**:::** 

A0A665VM40_BCL2L1-      SRRSQESFTKWLLAGMTLLTGVVVGSLIARKRL
A0A665VSD7_BCL2L1-      ARRSQEAARRWLLVGVALLTGVLMGVLIAKKQ-
                        :*****:  .***.*::*****::* ***.*. 

© 1998-2020Legal notice