Dataset for protein BCL-2-like of organism Dromaius novaehollandiae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4K2K9_MCL1-01      --PVGRPL---------------------------GGVCGPGLCGALEVG
A0A8C4JDK2_BCL2L1-      MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLN--
A0A8C4JDK2_BCL2L1-      MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLN--
                          . .* *                           . .  .*:.*.*:  

A0A8C4K2K9_MCL1-01      GHRLCPAAAGSSGGWGRPGPPPALGAGAR---------LQIASPAGMLR-
A0A8C4JDK2_BCL2L1-      ----------GSPSWHPPASHVVNGAAVHRSSLEVHETVQAADVRQALRE
A0A8C4JDK2_BCL2L1-      ----------GSPSWHPPASHVVNGAAVHRSSLEVHETVQAADVRQALRE
                                  .* .*  *..  . **...         :* *.    ** 

A0A8C4K2K9_MCL1-01      ------------------KLDIQKEEDLQSVCEVAAHVFSDGVTNWGRVV
A0A8C4JDK2_BCL2L1-      AGDEFELRYQRAFSDLTSQLHITPATAYQSFEQVVNELFRDGV-NWGRIV
A0A8C4JDK2_BCL2L1-      AGDEFELRYQRAFSDLTSQLHITPATAYQSFEQVVNELFRDGV-NWGRIV
                                          :* *      **. :*.  :* *** ****:*

A0A8C4K2K9_MCL1-01      TLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLVSQGGWEGF
A0A8C4JDK2_BCL2L1-      AFFSFGGALCVESVEKEMRVLVGRIVSWMTTYLTDHLDPWIQENGGWRCM
A0A8C4JDK2_BCL2L1-      AFFSFGGALCVESVEKEMRVLVGRIVSWMTTYLTDHLDPWIQENGGWERF
                        :::***. :.    . :    :. :.. :*  *..    *: .:***  :

A0A8C4K2K9_MCL1-01      VDFFRVEDLEGSIRNV---------LMAFAGVAGLGASLAYMIR
A0A8C4JDK2_BCL2L1-      --------------GLCPWEVYGLQMSEFSSCFCFGI-------
A0A8C4JDK2_BCL2L1-      VDLYGNNAAAEIRKGQETFNKWLLTGATVAGVLLLGSLLSRK--
                                      .             .:.   :*        

© 1998-2022Legal notice