Dataset for protein Mcl-1 of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2MG79_MCL1-01      MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLTAEEAKARREGGGEAGL
A0A8C2MG79_MCL1-02      MFGLRRNAVIGLNLYCGG--------------------------------
                        ******************                                

A0A8C2MG79_MCL1-01      LPGARVAVRPPPVGAEDPDVTASAERRLLRSPGLLAVPPEEMAAPASASS
A0A8C2MG79_MCL1-02      ----------------DPDVTASAERRLLRSPGLLAVPPEEMAAPASASS
                                        **********************************

A0A8C2MG79_MCL1-01      STAAAAAIMSPEEELDGCEPEALGKRPAVLPLLERVSSEAAKNPGAAGSL
A0A8C2MG79_MCL1-02      STAAAAAIMSPEEELDGCEPEALGKRPAVLPLLERVSSEAAKNPGAAGSL
                        **************************************************

A0A8C2MG79_MCL1-01      PSTPPSAEEEEDELYRQSLEIISRYLREQAAGVKDAKPLGEAGAAGRRAL
A0A8C2MG79_MCL1-02      PSTPPSAEEEEDELYRQSLEIISRYLREQAAGVKDAKPLGEAGAAGRRAL
                        **************************************************

A0A8C2MG79_MCL1-01      ETLRRVGDGVQRNHETAFQGMLRKMDIKNEDDVKSFSRVMVHVFKDGITN
A0A8C2MG79_MCL1-02      ETLRRVGDGVQRNHETAFQGMLRKMDIKNEDDVKSFSRVMVHVFKDGITN
                        **************************************************

A0A8C2MG79_MCL1-01      WGRIVTLISFGAYVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQR
A0A8C2MG79_MCL1-02      WGRIVTLISFGAYVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQR
                        **************************************************

A0A8C2MG79_MCL1-01      GWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A8C2MG79_MCL1-02      GWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                        ****************************************

© 1998-2022Legal notice