Dataset for protein Bfl1 of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5PYQ3_BCL2A1-      MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLD
A0A2K5PYQ3_BCL2A1-      MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLD
                        **************************************************

A0A2K5PYQ3_BCL2A1-      NVNIVSIDNARTIFSQVMETEFEDGIINWGRIVTIFAFEGILIKKLLQER
A0A2K5PYQ3_BCL2A1-      NVNIVSIDNARTIFSQVMETEFEDGIINWGRIVTIFAFEGILIKKLLQER
                        **************************************************

A0A2K5PYQ3_BCL2A1-      IAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWENGFVKKFEPKSGW---
A0A2K5PYQ3_BCL2A1-      IAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWGK-----------WHSL
                        ********************************* :           *   

A0A2K5PYQ3_BCL2A1-      -MTFLEVTGKICEMLSLLKQYY
A0A2K5PYQ3_BCL2A1-      MLMLVESVAQKKRKMAL-----
                         : ::* ..:    ::*     

© 1998-2020Legal notice