Dataset for protein Bfl1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0Q365_BCL2A1-      MSHLFGGSYDAQRCSGERRLPAVGFMFLWPTPESDEEEGAGPVVHTEIPP
A0A8C0Q365_BCL2A1-      MCPL---GRRGRKTGVSPSFCLVGWLTLKPTPESDEEEGAGPVVHTEIPP
                        *. *   .  ... . .  :  **:: *.*********************

A0A8C0Q365_BCL2A1-      ASTCRPESHPEPRQPRPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLAL
A0A8C0Q365_BCL2A1-      ASTCRPESHPEPRQPRPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLAL
                        **************************************************

A0A8C0Q365_BCL2A1-      AQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVV
A0A8C0Q365_BCL2A1-      AQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVV
                        **************************************************

A0A8C0Q365_BCL2A1-      SVDTARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDV
A0A8C0Q365_BCL2A1-      SVDTARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDV
                        **************************************************

A0A8C0Q365_BCL2A1-      DAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVLGT
A0A8C0Q365_BCL2A1-      DAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVLGT
                        **************************************************

A0A8C0Q365_BCL2A1-      VCEMWSHLKQYY
A0A8C0Q365_BCL2A1-      VCEMWSHLKQYY
                        ************

© 1998-2022Legal notice