Dataset for protein Bcl2l10 of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F4WGS2_BCL2L10      MADPLR-----VVADYLECCFREPGTPESPPSTAEAAVLRAMAAGVRKLY
F7CT87_BCL2L10-01       MADPLRQRTEQLVTDYLEYCSREPGTPESPPSTAEAAVLRAVAASVRKLY
                        ******     :*:**** * ********************:**.*****

A0A5F4WGS2_BCL2L10      RSFFSAYLLYPGNRGELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLER
F7CT87_BCL2L10-01       RSFFSAYLGYPGNRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLER
                        ******** ***** ***********************************

A0A5F4WGS2_BCL2L10      GPLVTARWKKWGFRSWLKEPEGDVARDCQRLVALMSPRLVGQHRAWLEAQ
F7CT87_BCL2L10-01       GPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQ
                        *************.*.******************:*.*************

A0A5F4WGS2_BCL2L10      GGWDGFCYFFRTSYSLALWRKLLVQVFLSWLLTAAFIYFWTR
F7CT87_BCL2L10-01       GGWDGFCYFFRTSSLLALWRKVLVQVFLSWLLTAVFIYFWTR
                        *************  ******:************.*******

© 1998-2020Legal notice