Dataset for protein BCL-2-like of organism Cairina moschata domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3GNC2_MCL1-01      --------------------------------------------MFALPR
A0A8C3BNR4_BCL2A1-      -------------------------------------------------M
A0A8C3CGW6_BCL2L1-      --------------------------------------------MSSGNR
A0A8C3CIW8_BCL2-01      PLGDLKHQSSRSLTFLKTWRCLGRVVAGVFCRGNLTEEHIYSPKRGYDNR
                                                                          

A0A8C3GNC2_MCL1-01      NALIGFNLYCGGGTGPGGGGGGGGGGGGPASTGGTPAPPPPSPHAAAPPP
A0A8C3BNR4_BCL2A1-      ETAEFYYVYYLAQDYLQ---------------------------------
A0A8C3CGW6_BCL2L1-      ELVIDFVAYKLSQKGYS---------------------------------
A0A8C3CIW8_BCL2-01      EIVLKYIHYKLSQRGYD---------------------------------
                        :    :  *  .                                      

A0A8C3GNC2_MCL1-01      PFPAARGAPCSLLIGSAAAPRSLIGSAAPPLWSPEEELDGCEPEAELGGP
A0A8C3BNR4_BCL2A1-      -------------------------------YVLQESH------------
A0A8C3CGW6_BCL2L1-      -------------------------------WSQLEEEDENRTEVAAEAD
A0A8C3CIW8_BCL2-01      -------------------------------WAAGEDRAPAPTALAPAAA
                                                       :   *.             

A0A8C3GNC2_MCL1-01      GGGGGGSLPGTPPELPTDELRQDSLELILRYLREAAGETEPGLKKFFPGL
A0A8C3BNR4_BCL2A1-      --------------------------------------------------
A0A8C3CGW6_BCL2L1-      AV-LNGSPSWHPPA-----------------------------GQVVNGA
A0A8C3CIW8_BCL2-01      AVAAAGTPSRHRPA-----------------------------G-LLSPH
                                                                          

A0A8C3GNC2_MCL1-01      LGRPGGVAGGDGVMEKALE--------TLRRVGDGVLEKHELAFQGMLRK
A0A8C3BNR4_BCL2A1-      -----------------LGPAQTRVAHVLRNIASSLQDQTEEALRPFLDR
A0A8C3CGW6_BCL2L1-      AVHRSGLEVRELVQSAGVRQ-------ALREAGDEFELRYRRAFSDLTSQ
A0A8C3CIW8_BCL2-01      PEPPGSAAASEAPPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQ
                                         :         .**  .. .  .    :  :  .

A0A8C3GNC2_MCL1-01      LEIKKE-EDLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFVARHLKSVKQ
A0A8C3BNR4_BCL2A1-      IDITSVDVAKRIFNGVMDEKFADGNTNWGRITTIFTFGGLLTKKLQEHGV
A0A8C3CGW6_BCL2L1-      LHITPG-TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEM
A0A8C3CIW8_BCL2-01      LHLTPF-TARGRFVAVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREM
                        : :.        .  *    * ** .****:.::: **. :     .   

A0A8C3GNC2_MCL1-01      EKS---IGSLARIITDALVSSKREWLVSQGGWEG-FVDFFRVED------
A0A8C3BNR4_BCL2A1-      QLTGEKKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRS------
A0A8C3CGW6_BCL2L1-      RVL---VGRIVAWMTTYLSDHLDPWIQENGGWER-FVDLYGNDAAAEMRK
A0A8C3CIW8_BCL2-01      SPL---VDSIAAWMTEYLNRHLHNWIQDNGGWDA-FVELYGNSMRPLFDF
                                 :   :*  :      *:  :***:  *:  :          

A0A8C3GNC2_MCL1-01      LEGSIRNVLMAFAGVAGLGASLAYMIRKACAGRIARGPMRIIALGAESGR
A0A8C3BNR4_BCL2A1-      --------LLSFSKITDLFVAVFSLFREYY--------------------
A0A8C3CGW6_BCL2L1-      GQETFNKWLLTGATVAGVLLLGSLLSRK----------------------
A0A8C3CIW8_BCL2-01      SWISLKT-ILSLVLVGACITLGAYLGHK----------------------
                                :::   :         : .:                      

A0A8C3GNC2_MCL1-01      SSVNRLGLRAQGDCFGFTPGVLASPRPKPRGLGVAGARYSELLVRAAPLS
A0A8C3BNR4_BCL2A1-      --------------------------------------------------
A0A8C3CGW6_BCL2L1-      --------------------------------------------------
A0A8C3CIW8_BCL2-01      --------------------------------------------------
                                                                          

A0A8C3GNC2_MCL1-01      ELRVRARRRLGKERSHPGGWQQVAGRRRSGAGAAR
A0A8C3BNR4_BCL2A1-      -----------------------------------
A0A8C3CGW6_BCL2L1-      -----------------------------------
A0A8C3CIW8_BCL2-01      -----------------------------------
                                                           

© 1998-2022Legal notice