Dataset for protein Bcl-xL of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2GX13_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
Q05KJ0_BCL2L1-02        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
Q05KJ0_BCL2L1-01        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
A0A4W2D608_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS-----------------GMKEH
A0A3Q1LRT3_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS--------------VRYGNPQW
A0A4W2F845_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS--------------VRYGNPQW
                        ****************************                    . 

A0A4W2GX13_BCL2L1-      INGNASWHLAD-----SPAVNGATGHSRSSDAREVIPMAAVKQALREAGD
Q05KJ0_BCL2L1-02        INGNASWHLAD-----SPAVNGATGHSRSSDAREVIPMAAVKQALREAGD
Q05KJ0_BCL2L1-01        INGNASWHLAD-----SPAVNGATGHSRSSDAREVIPMAAVKQALREAGD
A0A4W2D608_BCL2L1-      RTETPEGRESDMETPNSPTVNGATGHSRSLDARKMIPMTTVKQALREASN
A0A3Q1LRT3_BCL2L1-      ISGNPSWHLAD-----SPTVNGATGHSRSLDARKMIPMTTVKQALREASN
A0A4W2F845_BCL2L1-      ISGNPSWHLAD-----SPTVNGATGHSRSLDARKMIPMTTVKQALREASN
                         . ... . :*     **:********** ***::***::********.:

A0A4W2GX13_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFS
Q05KJ0_BCL2L1-02        EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFS
Q05KJ0_BCL2L1-01        EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFS
A0A4W2D608_BCL2L1-      EFKLWYQQTFSDLTSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFS
A0A3Q1LRT3_BCL2L1-      EFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFS
A0A4W2F845_BCL2L1-      EFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFS
                        **:*.*..:**** ***.****** ******:****** *:**.:*****

A0A4W2GX13_BCL2L1-      FGGALCVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELY
Q05KJ0_BCL2L1-02        FGGALCVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELY
Q05KJ0_BCL2L1-01        FGGALCVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELY
A0A4W2D608_BCL2L1-      FSGTICMKSIDKEIHVLVSQVTTSMATYLNNHLKPWIQENGGWDTFVELY
A0A3Q1LRT3_BCL2L1-      FSGTLCMKSIDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGWDTFVELY
A0A4W2F845_BCL2L1-      FSGTLCMKSIDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGWDTFVELY
                        *.*::*::*:***::****.::*  *****:**:****************

A0A4W2GX13_BCL2L1-      GNNAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK----------
Q05KJ0_BCL2L1-02        GNNAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK----------
Q05KJ0_BCL2L1-01        GNNAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK----------
A0A4W2D608_BCL2L1-      ESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRC--PYYV
A0A3Q1LRT3_BCL2L1-      ESNTTNESQKGQERFNC-WSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLS
A0A4W2F845_BCL2L1-      ESNTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRC--PYYV
                         .*:: **.**** **  :       : .:.    :::.           

A0A4W2GX13_BCL2L1-      -------
Q05KJ0_BCL2L1-02        -------
Q05KJ0_BCL2L1-01        -------
A0A4W2D608_BCL2L1-      GHSGSDR
A0A3Q1LRT3_BCL2L1-      GRYATLL
A0A4W2F845_BCL2L1-      GHSGSDR
                               

© 1998-2020Legal notice