Dataset for protein Bcl-w of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8HP19_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
L8HP19_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                      **************************************************

L8HP19_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
L8HP19_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                      **************************************************

L8HP19_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
L8HP19_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
                      **************************************************

L8HP19_BCL2L2-02      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
L8HP19_BCL2L2-01      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                      *******************************************

© 1998-2020Legal notice