Dataset for protein Bcl-w of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVR
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      SPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHHPA
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      PGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
                                                                   **:.*:*

A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2D6A3_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4W2GUJ7_BCL2L2-      AAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEP
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRAAGDEFET
                        . : . ...  .   *..  * ***  .***.....   .    .:*:*.

A0A4W2D6A3_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2D6A3_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2D6A3_BCL2L2-      ------EELLLEPEPEPEPEEEPPRPRAP---PGAPGPGP-------GSG
A0A4W2GUJ7_BCL2L2-      ------EELLLEPEPEPEPEEEPPRPRAP---PGAPGPGP-------GSG
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2D6A3_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
                              .:*  :    * . ::     :     *.*. *        *:.

A0A4W2D6A3_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGWA----
A0A4W2D6A3_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGWA----
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGWA----
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGWA----
A0A4W2D6A3_BCL2L2-      APGNQEEEEESGLVEGDPGDGAIEDP------------------------
A0A4W2GUJ7_BCL2L2-      APGNQEEEEESGLVEGDPGDGAIEDP------------------------
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGWFSQTS
A0A4W2D6A3_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGW-----
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGW-----
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLV------GQVQEWMVAYLETRLADWIHSSGGW-----
                          .:. ::* . **      * :::                         

A0A4W2D6A3_BCL2L2-      ---------------------------EFTALYG--DGALEEARRLRE--
A0A4W2D6A3_BCL2L2-      ---------------------------EFTALYG--DGALEEARRLRE--
A0A4W2GUJ7_BCL2L2-      ---------------------------EFTALYG--DGALEEARRLRE--
A0A4W2GUJ7_BCL2L2-      ---------------------------EFTALYG--DGALEEARRLRE--
A0A4W2D6A3_BCL2L2-      ---------------------------ELEAIKARVREMEEEAEKLKELQ
A0A4W2GUJ7_BCL2L2-      ---------------------------ELEAIKARVREMEEEAEKLKELQ
A0A4W2GUJ7_BCL2L2-      EAEMVHEVFFGEILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQ
A0A4W2D6A3_BCL2L2-      ---------------------------ELEAIKARVREMEEEAEKLKELQ
A0A4W2GUJ7_BCL2L2-      ---------------------------ELEAIKARVREMEEEAEKLKELQ
A0A4W2GUJ7_BCL2L2-      ---------------------------ELEAIKARVREMEEEAEKLKELQ
                                                   *: *: .      *** .*.*  

A0A4W2D6A3_BCL2L2-      -------------GNWASV------------RTVLTGAVALGALVTV---
A0A4W2D6A3_BCL2L2-      -------------GNWASV------------RTVLTGAVALGALVTV---
A0A4W2GUJ7_BCL2L2-      -------------GNWASV------------RTVLTGAVALGALVTV---
A0A4W2GUJ7_BCL2L2-      -------------GNWASV------------RTVLTGAVALGALVTV---
A0A4W2D6A3_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
A0A4W2GUJ7_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
A0A4W2GUJ7_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
A0A4W2D6A3_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
A0A4W2GUJ7_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
A0A4W2GUJ7_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
                                     ** ..*            *:: .* *  ** .     

A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A4W2GUJ7_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A4W2GUJ7_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A4W2D6A3_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A4W2GUJ7_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A4W2GUJ7_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
                                                                          

A0A4W2D6A3_BCL2L2-      -------------------------------------------------G
A0A4W2D6A3_BCL2L2-      -------------------------------------------------G
A0A4W2GUJ7_BCL2L2-      -------------------------------------------------G
A0A4W2GUJ7_BCL2L2-      -------------------------------------------------G
A0A4W2D6A3_BCL2L2-      QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
A0A4W2GUJ7_BCL2L2-      QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
A0A4W2GUJ7_BCL2L2-      QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
A0A4W2D6A3_BCL2L2-      QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
A0A4W2GUJ7_BCL2L2-      QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
A0A4W2GUJ7_BCL2L2-      QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
                                                                         *

A0A4W2D6A3_BCL2L2-      AFFASK----------
A0A4W2D6A3_BCL2L2-      AFFASK----------
A0A4W2GUJ7_BCL2L2-      AFFASK----------
A0A4W2GUJ7_BCL2L2-      AFFASK----------
A0A4W2D6A3_BCL2L2-      RVYRSG----------
A0A4W2GUJ7_BCL2L2-      RVYRSG----------
A0A4W2GUJ7_BCL2L2-      RVYRGRARATSWYSPY
A0A4W2D6A3_BCL2L2-      RVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      RVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      RVYRSG----------
                         .: .           

© 1998-2021Legal notice