Dataset for protein Bcl-w of organism Bos indicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      MAAAAAAAAAAGAAGGRGS-----------------GPGRRRHLVPGAGG
A0A4W2GUJ7_BCL2L2-      MAAAAAAAAAAGAAGGRGS-----------------GPGRRRHLVPGAGG
A0A4W2GUJ7_BCL2L2-      --MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASR
                                                                          

A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      EAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGA
A0A4W2GUJ7_BCL2L2-      EAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGA
A0A4W2GUJ7_BCL2L2-      VRSPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHH
                                                                          

A0A4W2D6A3_BCL2L2-      ---------------------------------------------MATPA
A0A4W2D6A3_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2D6A3_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2GUJ7_BCL2L2-      ---------------------------------------------MATPA
A0A4W2D6A3_BCL2L2-      PGPGPGSGAP--------------------GNQEEEEESGL---------
A0A4W2GUJ7_BCL2L2-      PGPGPGSGAP--------------------GNQEEEEESGL---------
A0A4W2GUJ7_BCL2L2-      PAPGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPA
                                                                          

A0A4W2D6A3_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2D6A3_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2D6A3_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
A0A4W2D6A3_BCL2L2-      -----------------------VEGDPGDGAIEDP--------------
A0A4W2GUJ7_BCL2L2-      -----------------------VEGDPGDGAIEDP--------------
A0A4W2GUJ7_BCL2L2-      SAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADP--------------
                                                 ..**:*.  **              

A0A4W2D6A3_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2D6A3_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2D6A3_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2GUJ7_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAA
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2D6A3_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----------
A0A4W2D6A3_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----------
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----------
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWFSQTSEAEMVH
A0A4W2D6A3_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----------
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----------
A0A4W2GUJ7_BCL2L2-      LCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW-----------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
                                                                          

A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      EVFFGEILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQNEVEKQ
A0A4W2D6A3_BCL2L2-      ---------------------ELEAIKARVREMEEEAEKLKELQNEVEKQ
A0A4W2GUJ7_BCL2L2-      ---------------------ELEAIKARVREMEEEAEKLKELQNEVEKQ
A0A4W2GUJ7_BCL2L2-      ---------------------ELEAIKARVREMEEEAEKLKELQNEVEKQ
A0A4W2D6A3_BCL2L2-      ---------------------ELEAIKARVREMEEEAEKLKELQNEVEKQ
A0A4W2GUJ7_BCL2L2-      ---------------------ELEAIKARVREMEEEAEKLKELQNEVEKQ
A0A4W2GUJ7_BCL2L2-      ---------------------LHQAMRAAGDEFE---TRFRRTFSDLAAQ
                                                                          

A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
A0A4W2D6A3_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
A0A4W2GUJ7_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
A0A4W2GUJ7_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
A0A4W2D6A3_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
A0A4W2GUJ7_BCL2L2-      MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
A0A4W2GUJ7_BCL2L2-      LHVTPG---------SAQQRFTQVSDELFQGGPNWGRLVAFF--VFGAAL
                                                                          

A0A4W2D6A3_BCL2L2-      ----------------AEF-------------------------------
A0A4W2D6A3_BCL2L2-      ----------------AEF-------------------------------
A0A4W2GUJ7_BCL2L2-      ----------------AEF-------------------------------
A0A4W2GUJ7_BCL2L2-      SVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKV
A0A4W2D6A3_BCL2L2-      SVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKV
A0A4W2GUJ7_BCL2L2-      SVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKV
A0A4W2GUJ7_BCL2L2-      SVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKV
A0A4W2D6A3_BCL2L2-      SVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKV
A0A4W2GUJ7_BCL2L2-      SVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQIKV
A0A4W2GUJ7_BCL2L2-      CAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEF---------
                                          :                               

A0A4W2D6A3_BCL2L2-      ---------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
A0A4W2D6A3_BCL2L2-      ---------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
A0A4W2GUJ7_BCL2L2-      ---------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
A0A4W2GUJ7_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GR
A0A4W2D6A3_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GR
A0A4W2GUJ7_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GR
A0A4W2GUJ7_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GR
A0A4W2D6A3_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GR
A0A4W2GUJ7_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---GR
A0A4W2GUJ7_BCL2L2-      ---------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
                                  :  . *      * *  *: * *: : ...   .    * 

A0A4W2D6A3_BCL2L2-      FFASK----------
A0A4W2D6A3_BCL2L2-      FFASK----------
A0A4W2GUJ7_BCL2L2-      FFASK----------
A0A4W2GUJ7_BCL2L2-      VYRGRARATSWYSPY
A0A4W2D6A3_BCL2L2-      VYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      VYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      VYRSG----------
A0A4W2D6A3_BCL2L2-      VYRSG----------
A0A4W2GUJ7_BCL2L2-      VYRSG----------
A0A4W2GUJ7_BCL2L2-      FFASK----------
                        .: .           

© 1998-2020Legal notice