Dataset for protein Bcl-xL of organism Apteryx owenii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9NWH6_BCL2L1-      MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEAGMAGVLNGS
A0A8B9NWH6_BCL2L1-      MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEAGMAGVLNGS
                        **************************************************

A0A8B9NWH6_BCL2L1-      PSWHPPASHIVNGAAVHRSSLEVHEIVQAADVRQALREAGDEFELRYRRA
A0A8B9NWH6_BCL2L1-      PSWHPPASHIVNGAAVHRSSLEVHEIVQAADVRQALREAGDEFELRYRRA
                        **************************************************

A0A8B9NWH6_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
A0A8B9NWH6_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
                        **************************************************

A0A8B9NWH6_BCL2L1-      VDKEMRVLVGRVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMR
A0A8B9NWH6_BCL2L1-      VDKEMRVLVGRVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMR
                        **************************************************

A0A8B9NWH6_BCL2L1-      KGQETFNKWLLTGATVAGVLLLGSLLSRK
A0A8B9NWH6_BCL2L1-      KGQETFNKWLLTGATVAGVLLLGSLLSRK
                        *****************************

© 1998-2022Legal notice