Dataset for protein Bcl-2 of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1LIC9_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAAPAAAAAAGPALSPVPPVVHLTLRQ
G1LIC9_BCL2-01      ----PHPAASPRPFVRR------------WQVAPPS-AAAAAAGPALSPVPPVVHLTLRQ
                         ... . * :* .            *:.. .: ***********************

G1LIC9_BCL2-02      AGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
G1LIC9_BCL2-01      AGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
                    ************************************************************

G1LIC9_BCL2-02      ESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGARPLE-----------------
G1LIC9_BCL2-01      ESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKA
                    ************************************ .   *                  

G1LIC9_BCL2-02      --------------------
G1LIC9_BCL2-01      LLSLALVGACITLGAYLGHK
                                        

© 1998-2020Legal notice