Dataset for protein BAX-like of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5KU58_BAX-03       ---MDGSGEQPRGGGEAGGRRAGGGFI-------------------QDRA
A0A2K5KU58_BAX-04       ---MDGSGEQPRGGG-----PTSSEQIMKTGALLLQGFI-------QDRA
A0A2K5L9Q9_BOK-01       MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSW
A0A2K5KTN5_BAK1-03      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5KTN5_BAK1-02      MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFD-----RHQQEQEAE
A0A2K5N1I8_BAK1-02      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A2K5N1I8_BAK1-01      MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAE
                              ..             .    :                       

A0A2K5KU58_BAX-03       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDS-------NMELQR
A0A2K5KU58_BAX-04       GRMGGETPELALDPVPQDASTKRLSECLKRIGDELDS-------NMELQR
A0A2K5L9Q9_BOK-01       SAPERAAP--------VPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQL
A0A2K5KTN5_BAK1-03      G-----------------STVGQVGRQI----------------TMLQHL
A0A2K5KTN5_BAK1-02      GPAAPADPEMVTLPLQPSSTVGQVGRQI----------------TMLQHL
A0A2K5N1I8_BAK1-02      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
A0A2K5N1I8_BAK1-01      GAAAPADPEMDTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQQL
                        .                 .    :   :                .:  : 

A0A2K5KU58_BAX-03       MIAAVDTDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFAS
A0A2K5KU58_BAX-04       MIAAVDTDSPREVFFRVAA----------DMFSDGNFNWGRVVALFYFAS
A0A2K5L9Q9_BOK-01       HISLQSEPVVTDAFLAVAG----------HIFSAG-ITWGKVVSLYAVAA
A0A2K5KTN5_BAK1-03      QRTAEN---AYEYFTKIAS----------SLFESG-INQGRVVALLGFSY
A0A2K5KTN5_BAK1-02      QRTAEN---AYEYFTKIAS----------SLFESG-INQGRVVALLGFSY
A0A2K5N1I8_BAK1-02      QPTAEN---AYEYFTKIASRPAATPTACLRVASTG-AVW-----------
A0A2K5N1I8_BAK1-01      QPTAEN---AYEYFTKIAS----------SLFESG-INWGRVVALLGFGY
                          :  .     : *  :*.           : . *   .           

A0A2K5KU58_BAX-03       KLVLKALCTKVPELIRTIMGWTL-DFLRERLLGWIQDQGGWDGLLSY---
A0A2K5KU58_BAX-04       KLVLKALCTKVPELIRTIMGWTL-DFLRERLLGWIQDQGGWVRLLNPPHP
A0A2K5L9Q9_BOK-01       GLAVDCVRQAQPAMVHALVDCLG-EFVRKTLATWLRRRGGWTDVLKCVVS
A0A2K5KTN5_BAK1-03      HLVLHVYQRGLTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDL---
A0A2K5KTN5_BAK1-02      HLVLHVYQRGLTGFLGQVTRFVV-FMLQHCIAWWIAQRGSWVAALDL---
A0A2K5N1I8_BAK1-02      ------------------------WLFWASATVW----------------
A0A2K5N1I8_BAK1-01      RLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNL---
                                                 :..     *                

A0A2K5KU58_BAX-03       -----FGTPTWQTVTILVAGVLTASLTIWKKMG------
A0A2K5KU58_BAX-04       NHRPCPTVPAHPLSQWCPLPIFGSSDVVYNAFPYVS---
A0A2K5L9Q9_BOK-01       TDPGL-------RSHWLVAALCSFGRFLKAAFFVLLPER
A0A2K5KTN5_BAK1-03      GNGPI-------LNMLVILGVVLLGPFVVQRFFKS----
A0A2K5KTN5_BAK1-02      GNGPI-------LNMLVILGVVLLGPFVVQRFFKS----
A0A2K5N1I8_BAK1-02      ---PY-------TSTSTA---------------------
A0A2K5N1I8_BAK1-01      GNGPI-------LNVLVVLGVVLLGQFVVRRFFKS----
                                                               

© 1998-2020Legal notice