Dataset for protein Bax of organism Castor canadensis

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A250YBQ3_BAX-01      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELTLEQM
A0A250YBQ3_BAX-02      -------------------MKTGALLLQGFIQDRAGRMGGETPELTLEQM
                                          *******************************

A0A250YBQ3_BAX-01      HQDASTKKLSECLKRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMF
A0A250YBQ3_BAX-02      HQDASTKKLSECLKRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMF
                       **************************************************

A0A250YBQ3_BAX-01      ADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLG
A0A250YBQ3_BAX-02      ADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLG
                       **************************************************

A0A250YBQ3_BAX-01      WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
A0A250YBQ3_BAX-02      WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
                       ******************************************

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice