Dataset for protein Bax of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5D846_BAX-04      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPV
A0A2K5D846_BAX-01      MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPV
                       **************************************************

A0A2K5D846_BAX-04      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5D846_BAX-01      PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
                       **************************************************

A0A2K5D846_BAX-04      SDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLG
A0A2K5D846_BAX-01      SDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLG
                       **************************************************

A0A2K5D846_BAX-04      WIQDQGGWVTLLPL----PIFRSSDVVSNAF------------
A0A2K5D846_BAX-01      WIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
                       ********  **.     * :.:  :.  ..            

© 1998-2020Legal notice