Dataset for protein Bak1 of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A493TW00_BAK1-01      MVWGWVSNFFFFFSVSLLLFPPPPRPCSLPSPAPRRCAPGRRQEGSGGDG
A0A493TW00_BAK1-02      MVWGWVSNFFFFFSVSLLLFPPPPRPCSLPSPAPRRCAPGRRQEGSGGDG
                        **************************************************

A0A493TW00_BAK1-01      AAPRRDALGLPGTPPGPPGPRREPVKLILPSISAMASGNDGDPPRAHGRR
A0A493TW00_BAK1-02      AAPRRDALGLPGTPPGPPGPRREPVKLILPSISAMASGNDGDPPRAHGRR
                        **************************************************

A0A493TW00_BAK1-01      GSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQEREESGEEVPLDPEI
A0A493TW00_BAK1-02      GSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQEREESGEEVPLDPEI
                        **************************************************

A0A493TW00_BAK1-01      AEIQQDLGSTGSLVGRRLAIIGDDINKRYDAEFRYMLKSLQLTKENAYDY
A0A493TW00_BAK1-02      AEIQQDLGSTGSLVGRRLAIIGDDINKRYDAEFRYMLKSLQLTKENAYDY
                        **************************************************

A0A493TW00_BAK1-01      FIKIASSLFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARYVTE
A0A493TW00_BAK1-02      FIKIASSLFESGINWGRVIALLGFGYCMAIHVYQHGITGFLRRIARYVTE
                        **************************************************

A0A493TW00_BAK1-01      FMLRNRIAQWIAQQGGWVAALDLDNVYMKYMLAVVALVMVGHLVVTIRLE
A0A493TW00_BAK1-02      FMLRNRIAQWIAQQGGWVAALDLDNVYMKYMLAVVALVMVGHLVVRRFFR
                        *********************************************   : 

A0A493TW00_BAK1-01      TVTGPV
A0A493TW00_BAK1-02      P-----
                        .     

© 1998-2020Legal notice