Dataset for protein Bmf of organism Equus asinus asinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4MCB2_BMF-02      MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLF
A0A8C4MCB2_BMF-01      MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLF
                       **************************************************

A0A8C4MCB2_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A8C4MCB2_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A8C4MCB2_BMF-02      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
A0A8C4MCB2_BMF-01      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQ
                       **************************************************

A0A8C4MCB2_BMF-02      QVGMG---------------AWGGGESSGDGGPGPASGLRLPSLKDKVLE
A0A8C4MCB2_BMF-01      QHQQNRNRVWWQTLLFLHNLALNGDENRNGAGPR----------------
                       *   .               * .*.*. ...**                 

A0A8C4MCB2_BMF-02      FWPNAVVIPVDWMGPTA
A0A8C4MCB2_BMF-01      -----------------
                                        

© 1998-2023Legal notice