Dataset for protein Bad of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5PDB1_BAD-01      MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASH
A0A2K5PDB1_BAD-03      MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASH
                       **************************************************

A0A2K5PDB1_BAD-01      QQGQPTSSSHHG---GAGAVETRSRHRSYPAGTEEDEGMEEEPSTFRG--
A0A2K5PDB1_BAD-03      QQGQPTSSSHHGENPSARMLSKTSAGMSSPATDSEAQHTENVKLEALGLW
                       ************   .*  :.. *   * **  .* :  *:      *  

A0A2K5PDB1_BAD-01      RSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSAS
A0A2K5PDB1_BAD-03      RPGVATDRTPQGRRRTKGWRRSPAPF--GAVRARHPPTSGQHSAMAASS-
                       *.  *. .   ..*  .  ** .  *  .     .* ::*  : *  *: 

A0A2K5PDB1_BAD-01      WTRVIQSWWDRNLGRGGSAPSQ
A0A2K5PDB1_BAD-03      ---------------GG-----
                                      **     

© 1998-2020Legal notice