Dataset for protein Bmf of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2EII1_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLF
Q05KI3_BMF-02          MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLF
Q05KI3_BMF-01          MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLF
A0A4W2INA4_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLF
                       **************************************************

A0A4W2EII1_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHA
Q05KI3_BMF-02          PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHA
Q05KI3_BMF-01          PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHA
A0A4W2INA4_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       ************************************************:*

A0A4W2EII1_BMF-01      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
Q05KI3_BMF-02          GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
Q05KI3_BMF-01          GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
A0A4W2INA4_BMF-01      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
                       **************************************************

A0A4W2EII1_BMF-01      QYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR
Q05KI3_BMF-02          QYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR
Q05KI3_BMF-01          QYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR
A0A4W2INA4_BMF-01      QYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR
                       **********************************

© 1998-2020Legal notice