Dataset for protein Bim of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1MV27_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A4W2D2G6_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A4W2G3J8_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A3Q1MV27_BCL2L11      MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQ
A0A3Q1MV27_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A4W2D2G6_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A4W2G3J8_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
                                                        ******************

A0A3Q1MV27_BCL2L11      LQPAERPPQLRPGAPTSLQTERQ---------------------------
A0A4W2D2G6_BCL2L11      LQPAERPPQLRPGAPTSLQTERQ---------------------------
A0A4W2G3J8_BCL2L11      LQPAERPPQLRPGAPTSLQTERQ---------------------------
A0A3Q1MV27_BCL2L11      LQPAERPPQLRPGAPTSLQTERQ---------------------------
A0A3Q1MV27_BCL2L11      LQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGP
A0A4W2D2G6_BCL2L11      LQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCLQGSPQGPLAPPASPGP
A0A4W2G3J8_BCL2L11      LQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGP
                        ***********************                           

A0A3Q1MV27_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A4W2D2G6_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A4W2G3J8_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A3Q1MV27_BCL2L11      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
A0A3Q1MV27_BCL2L11      FATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
A0A4W2D2G6_BCL2L11      FATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
A0A4W2G3J8_BCL2L11      FATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
                                                     *********************

A0A3Q1MV27_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
A0A4W2D2G6_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
A0A4W2G3J8_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
A0A3Q1MV27_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
A0A3Q1MV27_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
A0A4W2D2G6_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
A0A4W2G3J8_BCL2L11      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
                        **************************************************

A0A3Q1MV27_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2D2G6_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2G3J8_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A3Q1MV27_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A3Q1MV27_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2D2G6_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
A0A4W2G3J8_BCL2L11      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
                        ***************************

© 1998-2022Legal notice