Dataset for protein Bim of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1MV27_BCL2L11      --------------------------------MAKQPSDVSSECDREGGQ
A0A3Q1MV27_BCL2L11      MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQ
                                                        ******************

A0A3Q1MV27_BCL2L11      LQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYL
A0A3Q1MV27_BCL2L11      LQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYL
                        **************************************************

A0A3Q1MV27_BCL2L11      SAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEG
A0A3Q1MV27_BCL2L11      SAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEG
                        **************************************************

A0A3Q1MV27_BCL2L11      HPQMVLLRVLRYIVRLVWRMQ
A0A3Q1MV27_BCL2L11      HPQMVLLRVLRYIVRLVWRMQ
                        *********************

© 1998-2020Legal notice