Dataset for protein Bmf of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5E1Q4_BMF-02      MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K5E1Q4_BMF-01      MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K5E1Q4_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYASA
A0A2K5E1Q4_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************..*

A0A2K5E1Q4_BMF-02      EPKSRVVAGPPL-----SAQPGFEWR------------------------
A0A2K5E1Q4_BMF-01      GYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                         .  : *. *      .  *  :*.                        

A0A2K5E1Q4_BMF-02      -----REQEW--------------------GRPE
A0A2K5E1Q4_BMF-01      QHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR
                            *:. *                    . * 

© 1998-2020Legal notice