Dataset for protein classical BH3-containing proteins of organism Anser cygnoid

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9EN35_PMAIP1-      --------------------------------------------------
A0A8B9EP68_BCL2L11      -MKPCQPPPGPSRPAARRGRSRRPPAPARSPPARRSSSSGYFSFEAERS-
A0A8B9EVW2_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                                                                          

A0A8B9EN35_PMAIP1-      ---------------LPGAHPPQRDAVAEC--------------------
A0A8B9EP68_BCL2L11      ------------------PAPMSCDKATQTPSP---------PCQAVSH-
A0A8B9EVW2_BMF-01       LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                                            * . * .::                     

A0A8B9EN35_PMAIP1-      ------------------------------------------ALELRRIG
A0A8B9EP68_BCL2L11      ------------YLSAMASRWRSHLLAE------EIQPEIWIAQELRRIG
A0A8B9EVW2_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIA
                                                                  * :*. *.

A0A8B9EN35_PMAIP1-      DKADLRQRILNLIAKLFCPKT-----------------------------
A0A8B9EP68_BCL2L11      DE----------FNASYCPRR---------VIFLFLLSISLHLIVILRLL
A0A8B9EVW2_BMF-01       DQ----------FHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNHT
                        *:          :   .  .                              

A0A8B9EN35_PMAIP1-      -----------
A0A8B9EP68_BCL2L11      HYIIRLIWRMQ
A0A8B9EVW2_BMF-01       GQR--------
                                   

© 1998-2022Legal notice