Dataset for protein Bmf of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A493T7X1_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A493T7X1_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       **************************************************

A0A493T7X1_BMF-01      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A493T7X1_BMF-02      LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                       **************************************************

A0A493T7X1_BMF-01      RRLFYASAEQKSSV-VAAFSLSTQLGLKRGGEQEPHWAEVSFTHLFQATS
A0A493T7X1_BMF-02      RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIA
                       *****..*  .  *  ..*:*..:*  :    *:  .***.::. :*. :

A0A493T7X1_BMF-01      SL---------QGALNKHWFGGETCTPPAGCEDSEILLLVFKFGVLWTPL
A0A493T7X1_BMF-02      DQFHRLHIQRHQQNRNQVWW--------------QLFLFLHNLALN----
                       .          *   *: *:              :::*::.::.:     

A0A493T7X1_BMF-01      CCSLPCEAGSSCPTLSKESQNVGVFGKACCWVPAPVTSVQERQVLG
A0A493T7X1_BMF-02      -------------------------------VEANRNHTGQR----
                                                      * *  . . :*    

© 1998-2020Legal notice